PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7BL_07CC0B6EF.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 169aa    MW: 18777.4 Da    PI: 9.9248
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7BL_07CC0B6EF.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.14.4e-1464116355
                            XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                            + +r rr+ +NRe+ArrsR+RK a++  Le  v++L++e  +L k+l e +++
  Traes_7BL_07CC0B6EF.1  64 DTRRIRRMVSNRESARRSRRRKHAQLTDLELQVEQLKSESATLFKQLTEANQQ 116
                            56899***************************************777776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-1362126IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.74964116IPR004827Basic-leucine zipper domain
PfamPF001702.3E-1165116IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.2E-1266117No hitNo description
SuperFamilySSF579595.7E-1166118No hitNo description
PROSITE patternPS0003606984IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
FRVGKEIDRD TPGFCLTCCI VLVAASPRET ISGNQALETE SDSDSESLVE IGGGRCKRSG  60
KSSDTRRIRR MVSNRESARR SRRRKHAQLT DLELQVEQLK SESATLFKQL TEANQQFTTA  120
VTDNRILKSD VETLRIKVKM AEDMVARGAV SCGLGQQLGL APFLNSRKM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3613381e-180AK361338.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1138D02.
GenBankAK3632571e-180AK363257.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013M10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240308.12e-61PREDICTED: basic leucine zipper 9 isoform X1
SwissprotQ9FUD34e-38BZIP9_ARATH; Basic leucine zipper 9
TrEMBLW5HK721e-120W5HK72_WHEAT; Uncharacterized protein
STRINGMLOC_58027.41e-87(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20953796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.19e-28basic leucine zipper 9
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]